PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco015421.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 602aa    MW: 65558 Da    PI: 7.499
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco015421.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.21.8e-103994361954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  Aco015421.1 399 FEHflHPYPTDTDKQMLAKQTGLTRNQVSNWFINARVR 436
                  554459******************************88 PP

2BELL99.92e-32268336472
         BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  e q kk++L+sl+eeV krYkqy++q+++vi sFe vagl +a+pY+s+Alka+S+hF+cLk +i++q+
  Aco015421.1 268 EQQWKKTRLISLMEEVSKRYKQYYQQVHAVITSFESVAGLSTAAPYASMALKAMSKHFKCLKSMISNQL 336
                  7899**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.4E-39192334IPR006563POX domain
PfamPF075263.9E-37197333IPR006563POX domain
PROSITE profilePS5007112.293377440IPR001356Homeobox domain
CDDcd000861.04E-13380441No hitNo description
SMARTSM003894.1E-11380444IPR001356Homeobox domain
SuperFamilySSF466893.17E-17382448IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28383444IPR009057Homeodomain-like
PfamPF059205.6E-19397436IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MSAATGGYGG GGIGGDELFQ PQQHQHQHQH QQHQQNRGGG GQMYHVPQHS RREKLRFPPE  60
ESPPTSLLLL HDPHAARPPP PPPPPQQQQF YPPNLFSTSS SSTSHDPSSF GFGTPPSAQF  120
VPASHASFPH VYHHHPHYHH HHHHHHHQIP PLPLPLPLPL QQQQGFSLSL SSSSSNPPRG  180
VPVSAGPCGP FTGYAAVLNR SRFLGPAQQL LEEVCHVGRR AGVGDGGGGG DGSGDEGGLL  240
DMDPSETISA VDRGSDGGQE GPIAAGVEQQ WKKTRLISLM EEVSKRYKQY YQQVHAVITS  300
FESVAGLSTA APYASMALKA MSKHFKCLKS MISNQLRQTN KVLGKEGINK EDISSFGLVS  360
GGICLQRANN MGNFGQPHVW RPQRGLPERA VAVLRAWLFE HFLHPYPTDT DKQMLAKQTG  420
LTRNQVSNWF INARVRLWKP MVEEIHNLEM RQSQKLPSAD NDQSGIQQSH QPSDSSSNPS  480
GHSGGIDKNH NSTSKCIQSD VSQIPNSNIH EPINFVYDGL NSQQHIGVGV GLNGGNGGGV  540
SLTLGLHQNN RVCLAEPLPL TMVHRFGLED CNEAYMMGSF EGQDRQFSKD ISGHLLHDFV  600
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16386443158Homeobox protein Meis1
4xrs_B2e-16386443158Homeobox protein Meis1
5bng_A2e-16386444159Homeobox protein Meis2
5bng_B2e-16386444159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6613351e-161KM661335.1 Ananas bracteatus clone 43156 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811363.10.0PREDICTED: BEL1-like homeodomain protein 9
RefseqXP_008811362.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLJ3M7T01e-173J3M7T0_ORYBR; Uncharacterized protein
STRINGOB05G26540.11e-173(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-78TALE family protein